PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_28312A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 329aa    MW: 37439 Da    PI: 9.7984
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_28312AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.32.1e-25203252352
                     RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                ++i+l +++k+F+lpi++A+k+L++++++LK++CR+yGI+RWPhRkiksl
  Oropetium_20150105_28312A 203 ESITLVEIAKCFHLPIREASKTLKIGVSILKKKCREYGIPRWPHRKIKSL 252
                                689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.939187273IPR003035RWP-RK domain
PfamPF020422.1E-20204252IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MDAAVSTLTA LAIFESTVER GVVRSVHGYR VVGRKAGVGW VRWERWVERG FVLSADGSRE  60
VGVPPDAPRI LQAGWRSRPA FREGQTVGDW RCIVAFDSVA AVKPXXXXXX XXXXTGNPQL  120
KCLPNLYNDL EKVFQFQSVE NLPQLIHSDS EEQQQSIHSG ERDNISDETD YASGCYSDED  180
PQSGSELVPP VQRYRRAKRG HIESITLVEI AKCFHLPIRE ASKTLKIGVS ILKKKCREYG  240
IPRWPHRKIK SLDSLIHDVE SVLGDQARDD VEQKKYAFAI GALTKRKRML EREKENIRQK  300
PASDLLTETK QFREDVFKRR NRARRGRD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976506.11e-140PREDICTED: protein RKD5
TrEMBLF1DK111e-132F1DK11_MAIZE; NLP transcription factor (Fragment)
STRINGSb06g025420.11e-129(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.15e-47RWP-RK domain-containing protein